ALEXANDRIA, Va., March 5 -- United States Patent no. 12,239,720, issued on March 4, was assigned to Oncolyze Inc. (New York).

"Compositions for use in lysis of selective cancer cells" was invented by Steven Evans (New York).

According to the abstract* released by the U.S. Patent & Trademark Office: "The present invention relates to a method of necrosing, causing membranolysis, or causing poration of selective cancer cells. In some aspects, the method includes administering a peptide including PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG (SEQ ID NO:48) or ETFSDLWKLLKKWKMRRNQFWVKVQRG (SEQ ID NO:49) to a selective cancer cell to cause necrosis, membranolysis, or poration of said selective cancer cell."

The patent was filed on April 8, 2019, under Appli...