Intellectual Property India Publishes Patent Application for 'Protein-Based Material For Recovery And Separation Of Transition Metals' Filed by The Penn State Research Foundation

MUMBAI, India, March 28 -- Intellectual Property India has published a patent application (202517014617 A) filed by The Penn State Research Foundation, University Park, U.S.A., on Feb. 20, for 'protein-based material for recovery and separation of transition metals.'

Inventor(s) include Cotruvo, Jr. Joseph Alfred; and Park Jennifer.

The application for the patent was published on March 28, under issue no. 13/2025.

According to the abstract released by the Intellectual Property India: "Provided are proteins and protein-based sensors for detecting MnII. The proteins may have the following sequence: Z1-MPTTTTKVDIAAFDPDKDGTIHLKDALAAGSAAFDKLDPDKDGTLHAKDLKGRVSEADLKKLDPDX1DGTLHKKDYLAAVEAQFKAAX2PDNDGTIX3ARX4LASPAGSALVNLIRX5-Z2 (SEQ ID NO:1), whe...